SCOPe 2.07: Domain d4d6yb_: 4d6y B:

Lineage for d4d6yb_ (4d6y B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Brucella abortus [TaxId:235] [274729] (2 PDB entries)

8. Domain d4d6yb_: 4d6y B: [274730]
   automated match to d1zy2b_
   complexed with bef, mg

Details for d4d6yb_

PDB Entry: 4d6y, 1.7 Å

PDB Description: crystal structure of the receiver domain of ntrx from brucella abortus in complex with beryllofluoride and magnesium

PDB Compounds: (B:) bacterial regulatory, fis family protein

SCOPe Domain Sequences for d4d6yb_:

Sequence; same for both SEQRES and ATOM records:

>d4d6yb_ c.23.1.0 (B:) automated matches {Brucella abortus [TaxId: 235]}
dilvvddevdirdlvagilsdeghetrtafdadsalaaindraprlvfldiwlqgsrldg
lalldeikkqhpelpvvmisghgnietavsairrgaydfiekpfkadrlilvaeralets
k

Timeline for d4d6yb_:

• d4d6yb_ first appeared in SCOPe 2.05
  
• d4d6yb_ appears in SCOPe 2.06
  
• d4d6yb_ appears in the current release, SCOPe 2.08