Lineage for d1ak4b_ (1ak4 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301509Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 301510Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 301511Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 301517Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 301526Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 301598Domain d1ak4b_: 1ak4 B: [27473]
    Other proteins in same PDB: d1ak4c_, d1ak4d_
    mutant

Details for d1ak4b_

PDB Entry: 1ak4 (more details), 2.36 Å

PDB Description: human cyclophilin a bound to the amino-terminal domain of hiv-1 capsid

SCOP Domain Sequences for d1ak4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak4b_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1ak4b_:

Click to download the PDB-style file with coordinates for d1ak4b_.
(The format of our PDB-style files is described here.)

Timeline for d1ak4b_: