Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Colletotrichum graminicola [TaxId:645133] [274719] (2 PDB entries) |
Domain d5c92a2: 5c92 A:378-482 [274726] Other proteins in same PDB: d5c92a1 automated match to d1gofa1 complexed with act, cu1, nag |
PDB Entry: 5c92 (more details), 2.1 Å
SCOPe Domain Sequences for d5c92a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c92a2 b.1.18.0 (A:378-482) automated matches {Colletotrichum graminicola [TaxId: 645133]} gvtpakrpviqslsdtavragapititmqdagaytfsmirvsatthtvntdqrripldgq dggdgksftvnvpndygvaipgyymlfamneagvpcvaqffkvtl
Timeline for d5c92a2: