|  | Class b: All beta proteins [48724] (174 folds) | 
|  | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology | 
|  | Superfamily b.62.1: Cyclophilin-like [50891] (5 families)  | 
|  | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 | 
|  | Protein Cyclophilin (eukaryotic) [50893] (13 species) | 
|  | Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (58 PDB entries) Uniprot P05092 | 
|  | Domain d1awre_: 1awr E: [27468] | 
PDB Entry: 1awr (more details), 1.58 Å
SCOPe Domain Sequences for d1awre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1awre_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1awre_: