SCOPe 2.08: Domain d4zfgl1: 4zfg L:1-106

Lineage for d4zfgl1 (4zfg L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4zfgl1: 4zfg L:1-106 [274656]
   Other proteins in same PDB: d4zfgh_, d4zfgl2
   automated match to d1dn0a1
   complexed with ca, so4

Details for d4zfgl1

PDB Entry: 4zfg, 2.27 Å

PDB Description: dual-specificity fab 5a12 in complex with angiopoietin 2

PDB Compounds: (L:) Fragment antigen binding 5A12 light chain

SCOPe Domain Sequences for d4zfgl1:

Sequence; same for both SEQRES and ATOM records:

>d4zfgl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqflssfgvawyqqkpgkapklliygasslysgvp
srfsgsgsgtdftltisslqpedfatyycqqgllspltfgqgtkvei

Timeline for d4zfgl1:

• d4zfgl1 first appeared in SCOPe 2.05
  
• d4zfgl1 appears in SCOPe 2.07