SCOPe 2.07: Domain d3x0fa_: 3x0f A:

Lineage for d3x0fa_ (3x0f A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.135: Tetraspanin [48651] (1 superfamily)
   5 helices: irregular disulfide-linked array; form homodimer

4. Superfamily a.135.1: Tetraspanin [48652] (1 family)

5. Family a.135.1.1: Tetraspanin [48653] (2 proteins)

6. Protein automated matches [256548] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [274536] (1 PDB entry)

8. Domain d3x0fa_: 3x0f A: [274537]
   automated match to d4bkha_
   complexed with ipa

Details for d3x0fa_

PDB Entry: 3x0f, 1.47 Å

PDB Description: crystal structure of the ectodomain of mouse cd81 large extracellular loop (mcd81-lel)

PDB Compounds: (A:) CD81 antigen

SCOPe Domain Sequences for d3x0fa_:

Sequence; same for both SEQRES and ATOM records:

>d3x0fa_ a.135.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vnkdqiakdvkqfydqalqqavmdddannakavvktfhetlnccgsnalttltttilrns
lcpsggniltpllqqdchqkidelfsg

Timeline for d3x0fa_:

• d3x0fa_ first appeared in SCOPe 2.05
  
• d3x0fa_ appears in SCOPe 2.06
  
• d3x0fa_ appears in the current release, SCOPe 2.08