SCOPe 2.07: Domain d4qoga_: 4qog A:

Lineage for d4qoga_ (4qog A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d4qoga_: 4qog A: [274481]
   automated match to d4fgld_
   complexed with fad, ml1, zn

Details for d4qoga_

PDB Entry: 4qog, 1.4 Å

PDB Description: crystal structure of fad quinone reductase 2 in complex with melatonin at 1.4a

PDB Compounds: (A:) Ribosyldihydronicotinamide dehydrogenase [quinone]

SCOPe Domain Sequences for d4qoga_:

Sequence; same for both SEQRES and ATOM records:

>d4qoga_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
gkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtlsn
pevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvlc
qgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcgf
kvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfg

Timeline for d4qoga_:

• d4qoga_ first appeared in SCOPe 2.05
  
• d4qoga_ appears in SCOPe 2.06
  
• d4qoga_ appears in the current release, SCOPe 2.08