Lineage for d2rmaq_ (2rma Q:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 959125Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 959126Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 959127Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
  6. 959128Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 959143Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (56 PDB entries)
    Uniprot P05092
  8. 959197Domain d2rmaq_: 2rma Q: [27443]

Details for d2rmaq_

PDB Entry: 2rma (more details), 2.1 Å

PDB Description: crystal structures of cyclophilin a complexed with cyclosporin a and n-methyl-4-[(e)-2-butenyl]-4,4-dimethylthreonine cyclosporin a
PDB Compounds: (Q:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2rmaq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmaq_ b.62.1.1 (Q:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d2rmaq_:

Click to download the PDB-style file with coordinates for d2rmaq_.
(The format of our PDB-style files is described here.)

Timeline for d2rmaq_: