Class a: All alpha proteins [46456] (289 folds) |
Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily) Core: 3 helices; irregular array; disulfide-rich |
Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) automatically mapped to Pfam PF01392 |
Family a.141.1.0: automated matches [274414] (1 protein) not a true family |
Protein automated matches [274417] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [274420] (8 PDB entries) |
Domain d5bpba_: 5bpb A: [274425] Other proteins in same PDB: d5bpbb2 automated match to d1ijya_ complexed with nag |
PDB Entry: 5bpb (more details), 2.2 Å
SCOPe Domain Sequences for d5bpba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bpba_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp
Timeline for d5bpba_:
View in 3D Domains from other chains: (mouse over for more information) d5bpbb1, d5bpbb2, d5bpbc_, d5bpbd_ |