Lineage for d5bpba_ (5bpb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017090Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2017091Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2017111Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 2017112Protein automated matches [274417] (1 species)
    not a true protein
  7. 2017113Species Human (Homo sapiens) [TaxId:9606] [274420] (8 PDB entries)
  8. 2017118Domain d5bpba_: 5bpb A: [274425]
    Other proteins in same PDB: d5bpbb2
    automated match to d1ijya_
    complexed with nag

Details for d5bpba_

PDB Entry: 5bpb (more details), 2.2 Å

PDB Description: crystal structure of the cysteine-rich domain of human frizzled 4 - crystal form i
PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5bpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bpba_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp

SCOPe Domain Coordinates for d5bpba_:

Click to download the PDB-style file with coordinates for d5bpba_.
(The format of our PDB-style files is described here.)

Timeline for d5bpba_: