SCOP 1.75: Domain d1cwaa_: 1cwa A:

Lineage for d1cwaa_ (1cwa A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
   Uniprot P05092

8. Domain d1cwaa_: 1cwa A: [27434]
   complexed with aba

Details for d1cwaa_

PDB Entry: 1cwa, 2.1 Å

PDB Description: x-ray structure of a monomeric cyclophilin a-cyclosporin a crystal complex at 2.1 angstroms resolution

PDB Compounds: (A:) cyclophilin a

SCOP Domain Sequences for d1cwaa_:

Sequence; same for both SEQRES and ATOM records:

>d1cwaa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1cwaa_:

• d1cwaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwaa_ appears in SCOP 1.73
  
• d1cwaa_ appears in SCOPe 2.01
  
• d1cwaa_ appears in the current release, SCOPe 2.08