Lineage for d1cwaa_ (1cwa A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113906Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 113907Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 113908Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 113914Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 113921Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 113936Domain d1cwaa_: 1cwa A: [27434]

Details for d1cwaa_

PDB Entry: 1cwa (more details), 2.1 Å

PDB Description: x-ray structure of a monomeric cyclophilin a-cyclosporin a crystal complex at 2.1 angstroms resolution

SCOP Domain Sequences for d1cwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwaa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1cwaa_:

Click to download the PDB-style file with coordinates for d1cwaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cwaa_: