Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189245] (8 PDB entries) |
Domain d4up1b_: 4up1 B: [274331] automated match to d4eb4a_ complexed with so4 |
PDB Entry: 4up1 (more details), 2.99 Å
SCOPe Domain Sequences for d4up1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4up1b_ d.117.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pphgelqylgqiqhilrcgvrkddrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvl eellwfikgstnakelsskgvkiwdangsrdfldslgfstreegdlgpvygfqwrhfgae yrdmesdysgqgvdqlqrvidtiktnpddrriimcawnprdlplmalppchalcqfyvvn selscqlyqrsgdmglgvpfniasyalltymiahitglkpgdfihtlgdahiylnhiepl kiqlqreprpfpklrilrkvekiddfkaedfqiegynphptik
Timeline for d4up1b_: