Lineage for d1cwca_ (1cwc A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553286Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 1553301Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (58 PDB entries)
    Uniprot P05092
  8. 1553330Domain d1cwca_: 1cwc A: [27428]

Details for d1cwca_

PDB Entry: 1cwc (more details), 1.86 Å

PDB Description: improved binding affinity for cyclophilin a by a cyclosporin derivative singly modified at its effector domain
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d1cwca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1cwca_:

Click to download the PDB-style file with coordinates for d1cwca_.
(The format of our PDB-style files is described here.)

Timeline for d1cwca_: