Lineage for d2cpl__ (2cpl -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170368Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 170369Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 170370Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 170376Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 170383Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries)
  8. 170384Domain d2cpl__: 2cpl - [27420]

Details for d2cpl__

PDB Entry: 2cpl (more details), 1.63 Å

PDB Description: similarities and differences between human cyclophilin a and other beta-barrel structures. structural refinement at 1.63 angstroms resolution

SCOP Domain Sequences for d2cpl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpl__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d2cpl__:

Click to download the PDB-style file with coordinates for d2cpl__.
(The format of our PDB-style files is described here.)

Timeline for d2cpl__: