Class b: All beta proteins [48724] (178 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d5bw2a1: 5bw2 A:1-209 [274189] Other proteins in same PDB: d5bw2a2, d5bw2c2, d5bw2e2 automated match to d3sioc_ complexed with 4vu |
PDB Entry: 5bw2 (more details), 2.27 Å
SCOPe Domain Sequences for d5bw2a1:
Sequence, based on SEQRES records: (download)
>d5bw2a1 b.96.1.0 (A:1-209) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerra
>d5bw2a1 b.96.1.0 (A:1-209) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq trqvqhysccpepyidvnlvvkfrerra
Timeline for d5bw2a1: