SCOPe 2.07: Domain d5bp0j1: 5bp0 J:1-204

Lineage for d5bp0j1 (5bp0 J:1-204)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
   automatically mapped to Pfam PF02931

6. Protein automated matches [190922] (2 species)
   not a true protein

7. Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (35 PDB entries)

8. Domain d5bp0j1: 5bp0 J:1-204 [274168]
   Other proteins in same PDB: d5bp0a2, d5bp0b2, d5bp0c2, d5bp0d2, d5bp0e2, d5bp0f2, d5bp0g2, d5bp0h2, d5bp0i2, d5bp0j2
   automated match to d4alxa_
   complexed with fn1, nag, po4

Details for d5bp0j1

PDB Entry: 5bp0, 2.4 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 5-fluoronicotine (ti-4650)

PDB Compounds: (J:) acetylcholine-binding protein

SCOPe Domain Sequences for d5bp0j1:

Sequence, based on SEQRES records:

>d5bp0j1 b.96.1.1 (J:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records):

>d5bp0j1 b.96.1.1 (J:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptnsddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkk

Timeline for d5bp0j1:

• d5bp0j1 first appeared in SCOPe 2.05, called d5bp0j_
  
• d5bp0j1 appears in SCOPe 2.06
  
• d5bp0j1 appears in the current release, SCOPe 2.08