Lineage for d1avda_ (1avd A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1133647Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1133648Protein Avidin [50880] (1 species)
  7. 1133649Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries)
  8. 1133664Domain d1avda_: 1avd A: [27413]
    complexed with btn, nag

Details for d1avda_

PDB Entry: 1avd (more details), 2.7 Å

PDB Description: three-dimensional structure of the tetragonal crystal form of egg- white avidin in its functional complex with biotin at 2.7 angstroms resolution
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d1avda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avda_ b.61.1.1 (A:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
lrt

SCOPe Domain Coordinates for d1avda_:

Click to download the PDB-style file with coordinates for d1avda_.
(The format of our PDB-style files is described here.)

Timeline for d1avda_: