SCOPe 2.07: Domain d4zm8d_: 4zm8 D:

Lineage for d4zm8d_ (4zm8 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (13 species)
   not a true protein

7. Species Ixodes scapularis [TaxId:6945] [255931] (3 PDB entries)

8. Domain d4zm8d_: 4zm8 D: [274108]
   automated match to d3lh4a_

Details for d4zm8d_

PDB Entry: 4zm8, 2.68 Å

PDB Description: crystal structure of sialostatin l

PDB Compounds: (D:) Putative secreted cystatin

SCOPe Domain Sequences for d4zm8d_:

Sequence; same for both SEQRES and ATOM records:

>d4zm8d_ d.17.1.0 (D:) automated matches {Ixodes scapularis [TaxId: 6945]}
fggyseranhqanpeflnlahyatstwsaqqpgkthfdtvaevvkvetqvvagtnyrltl
kvaestceltstynkdtclpkadaahrtcttvvfenlqgdksvspfece

Timeline for d4zm8d_:

• d4zm8d_ first appeared in SCOPe 2.05
  
• d4zm8d_ appears in SCOPe 2.06
  
• d4zm8d_ appears in the current release, SCOPe 2.08