Lineage for d4zava_ (4zav A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472664Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472665Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2472704Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2472705Protein automated matches [190910] (9 species)
    not a true protein
  7. 2472731Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189793] (14 PDB entries)
  8. 2472733Domain d4zava_: 4zav A: [274091]
    automated match to d3zqua_
    complexed with 4ls, na, po4, scn

Details for d4zava_

PDB Entry: 4zav (more details), 1.4 Å

PDB Description: ubix in complex with a covalent adduct between dimethylallyl monophosphate and reduced fmn
PDB Compounds: (A:) UbiX

SCOPe Domain Sequences for d4zava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zava_ c.34.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
fvvarilntlgipqdmlprwgeqhlvsd

SCOPe Domain Coordinates for d4zava_:

Click to download the PDB-style file with coordinates for d4zava_.
(The format of our PDB-style files is described here.)

Timeline for d4zava_: