Lineage for d5boda_ (5bod A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579776Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2579777Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2580554Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2580555Protein automated matches [226867] (21 species)
    not a true protein
  7. 2580739Species Streptococcus pneumoniae [TaxId:171101] [273854] (2 PDB entries)
  8. 2580740Domain d5boda_: 5bod A: [273856]
    automated match to d4hymb1
    complexed with ttj

Details for d5boda_

PDB Entry: 5bod (more details), 2.2 Å

PDB Description: crystal structure of streptococcus pneumonia pare inhibitor
PDB Compounds: (A:) DNA topoisomerase 4 subunit B

SCOPe Domain Sequences for d5boda_:

Sequence, based on SEQRES records: (download)

>d5boda_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhaggkfgqggyktsgglhgvgssvvnalsswlev
eitrdgavykqrfenggkpvttlkkigtalksktgtkvtfmpdatifsttdfkyntiser
lnesafllknvtlsltdkrtdeaiefhyen

Sequence, based on observed residues (ATOM records): (download)

>d5boda_ d.122.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 171101]}
qvlegldavrkrpgmyigstdgaglhhlvweivdnavdealsgfgdridvtinkdgsltv
qdhgrgmptgmhamgiptveviftilhagssvvnalsswleveitrdgavykqrfenggk
pvttlkkigtalksktgtkvtfmpdatifsttdfkyntiserlnesafllknvtlsltdk
rtdeaiefhyen

SCOPe Domain Coordinates for d5boda_:

Click to download the PDB-style file with coordinates for d5boda_.
(The format of our PDB-style files is described here.)

Timeline for d5boda_: