Lineage for d5bnve_ (5bnv E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1725988Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries)
  8. 1726059Domain d5bnve_: 5bnv E: [273843]
    Other proteins in same PDB: d5bnva_, d5bnvd_
    automated match to d1s32b_
    protein/DNA complex; complexed with po4

Details for d5bnve_

PDB Entry: 5bnv (more details), 2.8 Å

PDB Description: crystal structure of human mcm2 hbd chaperoning a histone h3-h4 tetramer
PDB Compounds: (E:) histone h4

SCOPe Domain Sequences for d5bnve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnve_ a.22.1.1 (E:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
iqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtamd
vvyalkrqg

SCOPe Domain Coordinates for d5bnve_:

Click to download the PDB-style file with coordinates for d5bnve_.
(The format of our PDB-style files is described here.)

Timeline for d5bnve_: