Class a: All alpha proteins [46456] (289 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (12 species) not a true protein |
Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (6 PDB entries) |
Domain d4xfya2: 4xfy A:148-220 [273804] Other proteins in same PDB: d4xfya1 automated match to d2m8pa2 complexed with 1pe, cl |
PDB Entry: 4xfy (more details), 2.8 Å
SCOPe Domain Sequences for d4xfya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xfya2 a.28.3.0 (A:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqg
Timeline for d4xfya2: