Lineage for d4xfya2 (4xfy A:148-220)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319355Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2319709Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2319801Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2319802Protein automated matches [191156] (12 species)
    not a true protein
  7. 2319892Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (6 PDB entries)
  8. 2319898Domain d4xfya2: 4xfy A:148-220 [273804]
    Other proteins in same PDB: d4xfya1
    automated match to d2m8pa2
    complexed with 1pe, cl

Details for d4xfya2

PDB Entry: 4xfy (more details), 2.8 Å

PDB Description: structure of the native full-length dehydrated hiv-1 capsid protein
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d4xfya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfya2 a.28.3.0 (A:148-220) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqg

SCOPe Domain Coordinates for d4xfya2:

Click to download the PDB-style file with coordinates for d4xfya2.
(The format of our PDB-style files is described here.)

Timeline for d4xfya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfya1