SCOPe 2.06: Domain d4uu2b_: 4uu2 B:

Lineage for d4uu2b_ (4uu2 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:42895] [273737] (2 PDB entries)

8. Domain d4uu2b_: 4uu2 B: [273741]
   automated match to d3nx1b_
   complexed with gly, po4, so4; mutant

Details for d4uu2b_

PDB Entry: 4uu2, 1.49 Å

PDB Description: ferulic acid decarboxylase from enterobacter sp., single mutant

PDB Compounds: (B:) Ferulic acid decarboxylase

SCOPe Domain Sequences for d4uu2b_:

Sequence; same for both SEQRES and ATOM records:

>d4uu2b_ b.60.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 42895]}
mntfdkhdlsgfvgkhlvytydngweyeiyvknentldyrihsglvgnrwvkdqqayivr
vgesiykiswtaptgtdvslivnlgdslfhgtiffprwvmnnpektvcfqndhiplmnsy
rdagpayptevidefatitfvrdcgannesviacaaselpknfpdnl

Timeline for d4uu2b_:

• d4uu2b_ first appeared in SCOPe 2.05
  
• d4uu2b_ appears in SCOPe 2.07
  
• d4uu2b_ appears in the current release, SCOPe 2.08