Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d5a16d1: 5a16 D:1-111 [273622] Other proteins in same PDB: d5a16a_, d5a16b2, d5a16c_, d5a16d2, d5a16e_, d5a16f2, d5a16g_, d5a16h2 automated match to d1a5fl1 |
PDB Entry: 5a16 (more details), 2.5 Å
SCOPe Domain Sequences for d5a16d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a16d1 b.1.1.0 (D:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveik
Timeline for d5a16d1: