Lineage for d5a16f2 (5a16 F:112-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753056Domain d5a16f2: 5a16 F:112-218 [273625]
    Other proteins in same PDB: d5a16a_, d5a16b1, d5a16c_, d5a16d1, d5a16e_, d5a16f1, d5a16g_, d5a16h1
    automated match to d1tqbc2

Details for d5a16f2

PDB Entry: 5a16 (more details), 2.5 Å

PDB Description: crystal structure of fab4201 raised against human erythrocyte anion exchanger 1
PDB Compounds: (F:) fab4201 heavy chain

SCOPe Domain Sequences for d5a16f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a16f2 b.1.1.2 (F:112-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d5a16f2:

Click to download the PDB-style file with coordinates for d5a16f2.
(The format of our PDB-style files is described here.)

Timeline for d5a16f2: