Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4z7vg2: 4z7v G:129-219 [273589] Other proteins in same PDB: d4z7va1, d4z7vb1, d4z7vb2, d4z7vc1, d4z7vd1, d4z7vd2, d4z7ve1, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vh1, d4z7vh2 automated match to d2ak4d2 complexed with fuc, man, nag |
PDB Entry: 4z7v (more details), 2.65 Å
SCOPe Domain Sequences for d4z7vg2:
Sequence, based on SEQRES records: (download)
>d4z7vg2 b.1.1.2 (G:129-219) automated matches {Human (Homo sapiens) [TaxId: 9606]} niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn savawsnksdfacanafnnsiipedtffpsp
>d4z7vg2 b.1.1.2 (G:129-219) automated matches {Human (Homo sapiens) [TaxId: 9606]} niqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsa vawsnksdfacanafnnsiipedtffpsp
Timeline for d4z7vg2: