Lineage for d1vwfb_ (1vwf B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170266Domain d1vwfb_: 1vwf B: [27337]

Details for d1vwfb_

PDB Entry: 1vwf (more details), 1.92 Å

PDB Description: streptavidin complexed with cyclo-ac-[chpqgppc]-nh2 monomer, ph 3.67

SCOP Domain Sequences for d1vwfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwfb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d1vwfb_:

Click to download the PDB-style file with coordinates for d1vwfb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwfb_: