Lineage for d4zglf_ (4zgl F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2930021Species Helicobacter pylori [TaxId:85962] [257621] (1 PDB entry)
  8. 2930027Domain d4zglf_: 4zgl F: [273330]
    automated match to d4q61b_
    complexed with amp

Details for d4zglf_

PDB Entry: 4zgl (more details), 2.95 Å

PDB Description: hit like protein
PDB Compounds: (F:) Uncharacterized HIT-like protein HP_0404

SCOPe Domain Sequences for d4zglf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zglf_ d.13.1.0 (F:) automated matches {Helicobacter pylori [TaxId: 85962]}
mnvfekiiqgeipcskilenerflsfydinpkakvhalvipkqsiqdfngitpelmaqmt
sfifevveklgikekgyklltnvgknagqevmhlhfhilsgd

SCOPe Domain Coordinates for d4zglf_:

Click to download the PDB-style file with coordinates for d4zglf_.
(The format of our PDB-style files is described here.)

Timeline for d4zglf_: