![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
![]() | Protein automated matches [191122] (10 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [257621] (1 PDB entry) |
![]() | Domain d4zgla_: 4zgl A: [273323] automated match to d4q61b_ complexed with amp |
PDB Entry: 4zgl (more details), 2.95 Å
SCOPe Domain Sequences for d4zgla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zgla_ d.13.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]} mnvfekiiqgeipcskilenerflsfydinpkakvhalvipkqsiqdfngitpelmaqmt sfifevveklgikekgyklltnvgknagqevmhlhfhilsg
Timeline for d4zgla_: