Lineage for d4ytaa_ (4yta A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065466Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
    Uniprot P00760
  8. 2065546Domain d4ytaa_: 4yta A: [273295]
    automated match to d1j8aa_
    complexed with ben, ca, gol, so4

Details for d4ytaa_

PDB Entry: 4yta (more details), 1.2 Å

PDB Description: bond length analysis of asp, glu and his residues in trypsin at 1.2a resolution
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d4ytaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ytaa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4ytaa_:

Click to download the PDB-style file with coordinates for d4ytaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ytaa_: