SCOPe 2.08: Domain d2rtka_: 2rtk A:

Lineage for d2rtka_ (2rtk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d2rtka_: 2rtk A: [27328]
   complexed with act, gll, so4

Details for d2rtka_

PDB Entry: 2rtk, 1.82 Å

PDB Description: streptavidin-glycoluril complex, ph 2.58, space group i4122 prepared from an apostreptavidin crystal

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d2rtka_:

Sequence; same for both SEQRES and ATOM records:

>d2rtka_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2rtka_:

• d2rtka_ first appeared (with stable ids) in SCOP 1.55, called d2rtk__
  
• d2rtka_ appears in SCOPe 2.07