PDB entry 2rtk

View 2rtk on RCSB PDB site
Description: streptavidin-glycoluril complex, ph 2.58, space group i4122 prepared from an apostreptavidin crystal
Class: biotin-binding protein
Keywords: biotin-binding protein, streptavidin-small molecule ligand, designed small molecule ligand with micromolar affinity
Deposited on 1997-09-11, released 1998-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2rtka_
  • Heterogens: ACT, SO4, GLL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2rtkA (A:)
dpskdskaqvsaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
kstlvghdtftkvkp

    Sequence, based on observed residues (ATOM records): (download) 
    >2rtkA (A:)
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp