SCOP 1.59: Domain d1swgd_: 1swg D:

Lineage for d1swgd_ (1swg D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.61: Streptavidin-like [50875] (4 superfamilies)

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)

8. Domain d1swgd_: 1swg D: [27325]

Details for d1swgd_

PDB Entry: 1swg, 1.8 Å

PDB Description: circular permuted streptavidin e51/a46 in complex with biotin

SCOP Domain Sequences for d1swgd_:

Sequence, based on SEQRES records:

>d1swgd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
esryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwll
tsgtteanawkstlvghdtftkvkpsaasgggsaeagitgtwynqlgstfivtagadgal
tgtyes

Sequence, based on observed residues (ATOM records):

>d1swgd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
esryvltgrydsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwll
tsgtteanawkstlvghdtftkvgitgtwynqlgstfivtagadgaltgtyes

Timeline for d1swgd_:

• d1swgd_ first appeared (with stable ids) in SCOP 1.55
  
• d1swgd_ appears in SCOP 1.57
  
• d1swgd_ appears in SCOP 1.61
  
• d1swgd_ appears in the current release, SCOPe 2.08