Lineage for d4rydb1 (4ryd B:110-442)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129455Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2129656Protein automated matches [190073] (15 species)
    not a true protein
  7. 2129746Species Human (Homo sapiens) [TaxId:9606] [238473] (7 PDB entries)
  8. 2129758Domain d4rydb1: 4ryd B:110-442 [273173]
    Other proteins in same PDB: d4ryda2, d4rydb2, d4rydc2, d4rydd2, d4ryde2, d4rydf2
    automated match to d1p8ja2
    complexed with ca, fmt, na

Details for d4rydb1

PDB Entry: 4ryd (more details), 2.15 Å

PDB Description: x-ray structure of human furin in complex with the competitive inhibitor para-guanidinomethyl-phac-r-tle-r-amba
PDB Compounds: (B:) Furin

SCOPe Domain Sequences for d4rydb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rydb1 c.41.1.1 (B:110-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnydp
gasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmldg
evtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsif
vwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqnek
qivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlnan
dwatngvgrkvshsygyglldagamvalaqnwt

SCOPe Domain Coordinates for d4rydb1:

Click to download the PDB-style file with coordinates for d4rydb1.
(The format of our PDB-style files is described here.)

Timeline for d4rydb1: