Lineage for d4rcya3 (4rcy A:321-415)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793974Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2793975Protein automated matches [254425] (18 species)
    not a true protein
  7. 2794055Species Sulfolobus solfataricus [TaxId:273057] [256085] (13 PDB entries)
  8. 2794062Domain d4rcya3: 4rcy A:321-415 [273172]
    Other proteins in same PDB: d4rcya1, d4rcya2
    automated match to d4m53a3
    complexed with gdp, gtp, mg, mpd

Details for d4rcya3

PDB Entry: 4rcy (more details), 1.65 Å

PDB Description: structure of aif2-gamma d19a variant from sulfolobus solfataricus bound to gtp
PDB Compounds: (A:) Translation initiation factor 2 subunit gamma

SCOPe Domain Sequences for d4rcya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcya3 b.44.1.0 (A:321-415) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
aevpvlwnirikynllervvgakemlkvdpiraketlmlsvgssttlgivtsvkkdeiev
elrrpvavwsnnirtvisrqiagrwrmigwglvei

SCOPe Domain Coordinates for d4rcya3:

Click to download the PDB-style file with coordinates for d4rcya3.
(The format of our PDB-style files is described here.)

Timeline for d4rcya3: