Lineage for d1slgb_ (1slg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805956Domain d1slgb_: 1slg B: [27315]

Details for d1slgb_

PDB Entry: 1slg (more details), 1.76 Å

PDB Description: streptavidin, ph 5.6, bound to peptide fchpqnt
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1slgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1slgb_:

Click to download the PDB-style file with coordinates for d1slgb_.
(The format of our PDB-style files is described here.)

Timeline for d1slgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1slgd_