SCOPe 2.08: Domain d1slgb_: 1slg B:

Lineage for d1slgb_ (1slg B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d1slgb_: 1slg B: [27315]

Details for d1slgb_

PDB Entry: 1slg, 1.76 Å

PDB Description: streptavidin, ph 5.6, bound to peptide fchpqnt

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1slgb_:

Sequence; same for both SEQRES and ATOM records:

>d1slgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d1slgb_:

• d1slgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1slgb_ appears in SCOPe 2.07