Lineage for d1slgb_ (1slg B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16670Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 16671Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 16684Protein Streptavidin [50878] (1 species)
  7. 16685Species Streptomyces avidinii [TaxId:1895] [50879] (84 PDB entries)
  8. 16771Domain d1slgb_: 1slg B: [27315]

Details for d1slgb_

PDB Entry: 1slg (more details), 1.76 Å

PDB Description: streptavidin, ph 5.6, bound to peptide fchpqnt

SCOP Domain Sequences for d1slgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slgb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOP Domain Coordinates for d1slgb_:

Click to download the PDB-style file with coordinates for d1slgb_.
(The format of our PDB-style files is described here.)

Timeline for d1slgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1slgd_