SCOPe 2.08: Domain d4p44a2: 4p44 A:118-350

Lineage for d4p44a2 (4p44 A:118-350)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.4: PA domain [52025] (1 family)

5. Family c.8.4.1: PA domain [52026] (2 proteins)

6. Protein Glutamate carboxypeptidase II [141984] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141985] (34 PDB entries)
   Uniprot Q04609 118-350

8. Domain d4p44a2: 4p44 A:118-350 [272895]
   Other proteins in same PDB: d4p44a1, d4p44a3
   automated match to d2c6ca2
   complexed with 2f7, ca, cl, nag, zn

Details for d4p44a2

PDB Entry: 4p44, 1.75 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor jrb-4-81

PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d4p44a2:

Sequence; same for both SEQRES and ATOM records:

>d4p44a2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

Timeline for d4p44a2:

• d4p44a2 first appeared in SCOPe 2.05
  
• d4p44a2 appears in SCOPe 2.07