SCOPe 2.06: Domain d4opza_: 4opz A:

Lineage for d4opza_ (4opz A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d4opza_: 4opz A: [272869]
   automated match to d4ibra_
   complexed with 2ul, act, ca, edo; mutant

Details for d4opza_

PDB Entry: 4opz, 1.45 Å

PDB Description: crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation in complex with boron-based inhibitor ec25

PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4opza_:

Sequence; same for both SEQRES and ATOM records:

>d4opza_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Timeline for d4opza_:

• d4opza_ first appeared in SCOPe 2.05
  
• d4opza_ appears in SCOPe 2.07
  
• d4opza_ appears in the current release, SCOPe 2.08