SCOPe 2.08: Domain d4op8a_: 4op8 A:

Lineage for d4op8a_ (4op8 A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d4op8a_: 4op8 A: [272867]
   automated match to d4ibra_
   complexed with ca, pg4, so4; mutant

Details for d4op8a_

PDB Entry: 4op8, 1.95 Å

PDB Description: room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s mutation

PDB Compounds: (A:) TEM-94 ES-beta-lactamase

SCOPe Domain Sequences for d4op8a_:

Sequence; same for both SEQRES and ATOM records:

>d4op8a_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
hpetlvkvkdaedqlggrvgyieldlasgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvgelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpvamattlrklltgelltaasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviymtg
sqatmdernrqiaeigaslikhw

Timeline for d4op8a_:

• d4op8a_ first appeared in SCOPe 2.05
  
• d4op8a_ appears in SCOPe 2.07