Lineage for d4zk1f1 (4zk1 F:1-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428908Protein automated matches [190922] (2 species)
    not a true protein
  7. 2428909Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (35 PDB entries)
  8. 2428935Domain d4zk1f1: 4zk1 F:1-210 [272826]
    Other proteins in same PDB: d4zk1a2, d4zk1b2, d4zk1c2, d4zk1d2, d4zk1e2, d4zk1f2, d4zk1g2, d4zk1h2, d4zk1i2, d4zk1j2
    automated match to d4alxa_
    complexed with 4p7, po4

Details for d4zk1f1

PDB Entry: 4zk1 (more details), 1.75 Å

PDB Description: crystal structure of lymnaea stagnalis acetylcholine-binding protein (lsachbp) in complex with 3-pyrrolylmethylene anabaseine
PDB Compounds: (F:) acetylcholine-binding protein

SCOPe Domain Sequences for d4zk1f1:

Sequence, based on SEQRES records: (download)

>d4zk1f1 b.96.1.1 (F:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkgrseil

Sequence, based on observed residues (ATOM records): (download)

>d4zk1f1 b.96.1.1 (F:1-210) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkkgrseil

SCOPe Domain Coordinates for d4zk1f1:

Click to download the PDB-style file with coordinates for d4zk1f1.
(The format of our PDB-style files is described here.)

Timeline for d4zk1f1: