Lineage for d4qdba_ (4qdb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188632Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)
  8. 2188653Domain d4qdba_: 4qdb A: [272699]
    automated match to d2b6ed_
    mutant

Details for d4qdba_

PDB Entry: 4qdb (more details), 2.02 Å

PDB Description: crystal structure of mutant thioesterase pa1618 (q49a) from pseudomonas aeruginosa
PDB Compounds: (A:) Thioesterase PA1618

SCOPe Domain Sequences for d4qdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qdba_ d.38.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthapfgllhggasvv
laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl

SCOPe Domain Coordinates for d4qdba_:

Click to download the PDB-style file with coordinates for d4qdba_.
(The format of our PDB-style files is described here.)

Timeline for d4qdba_: