| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
| Protein automated matches [190143] (36 species) not a true protein |
| Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries) |
| Domain d4qdba_: 4qdb A: [272699] automated match to d2b6ed_ mutant |
PDB Entry: 4qdb (more details), 2.02 Å
SCOPe Domain Sequences for d4qdba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qdba_ d.38.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthapfgllhggasvv
laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl
Timeline for d4qdba_: