Lineage for d4qdad_ (4qda D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944535Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)
  8. 2944565Domain d4qdad_: 4qda D: [272678]
    automated match to d2b6eb_
    mutant

Details for d4qdad_

PDB Entry: 4qda (more details), 2.3 Å

PDB Description: crystal structure of mutant thioesterase pa1618 (e64a) from pseudomonas aeruginosa
PDB Compounds: (D:) Thioesterase PA1618

SCOPe Domain Sequences for d4qdad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qdad_ d.38.1.0 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthqpfgllhggasvv
laaslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl

SCOPe Domain Coordinates for d4qdad_:

Click to download the PDB-style file with coordinates for d4qdad_.
(The format of our PDB-style files is described here.)

Timeline for d4qdad_: