SCOPe 2.07: Domain d4qd9c_: 4qd9 C:

Lineage for d4qd9c_ (4qd9 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (41 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)

8. Domain d4qd9c_: 4qd9 C: [272671]
   automated match to d2b6ef_
   complexed with 31b

Details for d4qd9c_

PDB Entry: 4qd9, 1.77 Å

PDB Description: crystal structure of thioesterase pa1618 from pseudomonas aeruginosa in complex with benzoyl-do-coa

PDB Compounds: (C:) Thioesterase PA1618

SCOPe Domain Sequences for d4qd9c_:

Sequence; same for both SEQRES and ATOM records:

>d4qd9c_ d.38.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
slwrqtpdleqlnasqknsigdllgirfeafddesltasmpvdsrthqpfgllhggasvv
laeslgsmasylcvdtsqyycvglevnanhlrglrsgrvtavaraihlgrtthvwdirls
gddgkpsciarltmavvpl

Timeline for d4qd9c_:

• d4qd9c_ first appeared in SCOPe 2.05
  
• d4qd9c_ appears in SCOPe 2.06
  
• d4qd9c_ appears in the current release, SCOPe 2.08