Lineage for d2izfd_ (2izf D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113687Fold b.61: Streptavidin-like [50875] (4 superfamilies)
  4. 113688Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 113689Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 113704Protein Streptavidin [50878] (1 species)
  7. 113705Species Streptomyces avidinii [TaxId:1895] [50879] (85 PDB entries)
  8. 113743Domain d2izfd_: 2izf D: [27263]

Details for d2izfd_

PDB Entry: 2izf (more details), 1.58 Å

PDB Description: streptavidin-biotin ph 4.0 i222 complex

SCOP Domain Sequences for d2izfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izfd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

SCOP Domain Coordinates for d2izfd_:

Click to download the PDB-style file with coordinates for d2izfd_.
(The format of our PDB-style files is described here.)

Timeline for d2izfd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2izfb_