SCOPe 2.05: Domain d4umsa_: 4ums A:

Lineage for d4umsa_ (4ums A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Bacteroides cellulosolvens [TaxId:35825] [189900] (2 PDB entries)

8. Domain d4umsa_: 4ums A: [272407]
   automated match to d2ccla_

Details for d4umsa_

PDB Entry: 4ums, 1.84 Å

PDB Description: the crystal structure of the seventh scab type i cohesin from pseudobacteroides cellulosolvens

PDB Compounds: (A:) cellulosomal anchoring scaffoldin b

SCOPe Domain Sequences for d4umsa_:

Sequence; same for both SEQRES and ATOM records:

>d4umsa_ b.2.2.0 (A:) automated matches {Bacteroides cellulosolvens [TaxId: 35825]}
mywmnvvigkmnaevggevvvpiefnnvpsfginncdfklvydatalelknveagdiikt
planfsnnkseegkisflfndasqgsmqienggvfakitfkvksttatgvydlrkdlvgs
fsglkdnkmtsigaeftngsitvaataplehhhh

Timeline for d4umsa_:

• d4umsa_ is new in SCOPe 2.05-stable
  
• d4umsa_ is called d4umsa1 in SCOPe 2.06
  
• d4umsa_ appears in the current release, SCOPe 2.08, called d4umsa1