SCOPe 2.06: Domain d4pc3b1: 4pc3 B:8-204

Lineage for d4pc3b1 (4pc3 B:8-204)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [272301] (1 PDB entry)

8. Domain d4pc3b1: 4pc3 B:8-204 [272302]
   Other proteins in same PDB: d4pc3a2, d4pc3a3, d4pc3b2, d4pc3b3, d4pc3c1, d4pc3c2, d4pc3c3, d4pc3d1, d4pc3d2, d4pc3d3
   automated match to d1d8ta3
   complexed with gdp, gol

Details for d4pc3b1

PDB Entry: 4pc3, 1.83 Å

PDB Description: elongation factor tu:ts complex with partially bound gdp

PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d4pc3b1:

Sequence, based on SEQRES records:

>d4pc3b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Sequence, based on observed residues (ATOM records):

>d4pc3b1 c.37.1.8 (B:8-204) automated matches {Escherichia coli [TaxId: 83333]}
tkphvnvgtighvdhgkttltaaittvlaktyggkargitintshveydtptrhyahvdc
pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd
deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe
per

Timeline for d4pc3b1:

• d4pc3b1 first appeared in SCOPe 2.05
  
• d4pc3b1 appears in SCOPe 2.07
  
• d4pc3b1 appears in the current release, SCOPe 2.08