SCOPe 2.01: Domain d1eioa_: 1eio A:

Lineage for d1eioa_ (1eio A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Ileal lipid-binding protein [50870] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50871] (2 PDB entries)

8. Domain d1eioa_: 1eio A: [27228]
   complexed with gch

Details for d1eioa_

PDB Entry: 1eio

PDB Description: ileal lipid binding protein in complex with glycocholate

PDB Compounds: (A:) ileal lipid binding protein

SCOPe Domain Sequences for d1eioa_:

Sequence; same for both SEQRES and ATOM records:

>d1eioa_ b.60.1.2 (A:) Ileal lipid-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
aftgkyeieseknydefmkrlalpsdaidkarnlkiisevkqdgqnftwsqqypgghsit
ntftigkecdietiggkkfkatvqmeggkvvvnspnyhhtaeivdgklvevstvggvsye
rvskkla

Timeline for d1eioa_:

• d1eioa_ first appeared (with stable ids) in SCOP 1.55
  
• d1eioa_ appears in SCOP 1.75
  
• d1eioa_ appears in SCOPe 2.02
  
• d1eioa_ appears in the current release, SCOPe 2.08