Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Ileal lipid-binding protein [50870] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50871] (2 PDB entries) |
Domain d1eioa_: 1eio A: [27228] complexed with gch |
PDB Entry: 1eio (more details)
SCOPe Domain Sequences for d1eioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eioa_ b.60.1.2 (A:) Ileal lipid-binding protein {Pig (Sus scrofa) [TaxId: 9823]} aftgkyeieseknydefmkrlalpsdaidkarnlkiisevkqdgqnftwsqqypgghsit ntftigkecdietiggkkfkatvqmeggkvvvnspnyhhtaeivdgklvevstvggvsye rvskkla
Timeline for d1eioa_: