Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species Homo sapiens, [TaxId:9606] [272119] (5 PDB entries) |
Domain d5afma_: 5afm A: [272172] Other proteins in same PDB: d5afmb_ automated match to d4uxua_ complexed with 9z0, gol, l0b, nag |
PDB Entry: 5afm (more details), 2.85 Å
SCOPe Domain Sequences for d5afma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5afma_ b.96.1.0 (A:) automated matches {Homo sapiens, [TaxId: 9606]} gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr serfyecckepypdvtftvtfrkkg
Timeline for d5afma_:
View in 3D Domains from other chains: (mouse over for more information) d5afmb_, d5afmc_, d5afmd_, d5afme_ |