Lineage for d5afmc_ (5afm C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1811013Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 1811014Protein automated matches [193506] (5 species)
    not a true protein
  7. 1811357Species Homo sapiens, [TaxId:9606] [272119] (5 PDB entries)
  8. 1811379Domain d5afmc_: 5afm C: [272174]
    Other proteins in same PDB: d5afmb_
    automated match to d4uxua_
    complexed with 9z0, gol, l0b, nag

Details for d5afmc_

PDB Entry: 5afm (more details), 2.85 Å

PDB Description: alpha7-achbp in complex with lobeline and fragment 4
PDB Compounds: (C:) acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7

SCOPe Domain Sequences for d5afmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afmc_ b.96.1.0 (C:) automated matches {Homo sapiens, [TaxId: 9606]}
gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
serfyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d5afmc_:

Click to download the PDB-style file with coordinates for d5afmc_.
(The format of our PDB-style files is described here.)

Timeline for d5afmc_: